DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Mfrp

DIOPT Version :10

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_667337.1 Gene:Mfrp / 259172 MGIID:2385957 Length:584 Species:Mus musculus


Alignment Length:113 Identity:39/113 - (34%)
Similarity:58/113 - (51%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CEPITISICKNIPYNMTIMPNL-IGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI 116
            |||:.:.:|..:.||.|..||: :|...|.|....:..:..|..:.|....|.|||.|.||.||.
Mouse   471 CEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTS 535

  Fly   117 LERPIPPCRSLCESA-RVCEKLMKTYNFNWPENLECSKFPVHGGEDLC 163
            |...:|||||:|::| :.|:..:......||.|  |::.||....:.|
Mouse   536 LGTILPPCRSVCQAAEQQCQSSLALLGTPWPFN--CNRLPVAASLEAC 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 39/113 (35%)
7tmF_FZD1_insect 236..568 CDD:320376
TM helix 1 245..270 CDD:320376
TM helix 2 279..300 CDD:320376
TM helix 3 338..364 CDD:320376
TM helix 4 381..397 CDD:320376
TM helix 5 419..448 CDD:320376
TM helix 6 468..495 CDD:320376
TM helix 7 527..552 CDD:320376
MfrpNP_667337.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..140
CUB 150..258 CDD:238001
LDLa 266..300 CDD:238060
CUB 307..419 CDD:238001
CRD_FZ 470..584 CDD:143549 39/113 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.