DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and FRZB

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001454.2 Gene:FRZB / 2487 HGNCID:3959 Length:325 Species:Homo sapiens


Alignment Length:152 Identity:62/152 - (40%)
Similarity:88/152 - (57%) Gaps:6/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLMASSGTELDGLP--HHNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIG 97
            ||:|.:...|..:|  ....|||:.|.:||::|:|||.|||.:.|:.|..|.|.:.||..|:...
Human    15 GLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTH 79

  Fly    98 CSDDLQLFLCSLYVPVCTI--LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGG 159
            ||.||..|||::|.|:|||  ...||.||:|:||.||. ||.::..|..:|||||.|.:.||: .
Human    80 CSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVY-D 143

  Fly   160 EDLCVAENTTSSASTAATPTRS 181
            ..:|::.....:|..|..|..|
Human   144 RGVCISPEAIVTADGADFPMDS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 53/118 (45%)
Frizzled 237..564 CDD:279827
FRZBNP_001454.2 CRD_SFRP3 32..157 CDD:143550 53/125 (42%)
NTR_Sfrp3_like 188..297 CDD:239636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.