DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and Frzb

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_035486.1 Gene:Frzb / 20378 MGIID:892032 Length:323 Species:Mus musculus


Alignment Length:190 Identity:68/190 - (35%)
Similarity:97/190 - (51%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI- 116
            |||:.|.:||::|:|||.|||.:.|:.|..|.|.:.||..|:...||.||..|||::|.|:||| 
Mouse    35 CEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTID 99

  Fly   117 -LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPT 179
             ...||.||:|:||.||. ||.::..|..:|||:|.|.:.||: ...:|::.....:|..|..|.
Mouse   100 FQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVY-DRGVCISPEAIVTADGADFPM 163

  Fly   180 RSVAKVTTRKHQTGVESPHRNIGFVC---PVQL--KTPLGMGYELKVGGKDLHDCGAPCH 234
            .|     :..|..|..|..      |   ||:.  ||.....|...:..| :.:....||
Mouse   164 DS-----STGHCRGASSER------CKCKPVRATQKTYFRNNYNYVIRAK-VKEVKMKCH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 52/116 (45%)
Frizzled 237..564 CDD:279827
FrzbNP_035486.1 CRD_SFRP3 32..157 CDD:143550 52/122 (43%)
NTR_Sfrp3_like 188..297 CDD:239636 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.