DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and sfrp-1

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:135 Identity:49/135 - (36%)
Similarity:69/135 - (51%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI-LE 118
            |..:|||..|.|....:||::.|....||......:..|:::.|..|.|.|||||:.|||.: ::
 Worm    41 PSNLSICNGIEYTQMRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLMQMD 105

  Fly   119 RPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDLCV----AENTTSSASTAATP 178
            |.|.||:|||.:.:. ||..|..|.|.|||.|.|.||.   .:|:|:    .....:.:||..|.
 Worm   106 RLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFE---DDDMCIKPMQPAKPPAGSSTTCTA 167

  Fly   179 TRSVA 183
            ...||
 Worm   168 CSQVA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 44/117 (38%)
Frizzled 237..564 CDD:279827
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:382974 44/122 (36%)
NTR_Sfrp1_like 162..283 CDD:239635 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.