DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and sfrp-1

DIOPT Version :10

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:135 Identity:49/135 - (36%)
Similarity:69/135 - (51%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI-LE 118
            |..:|||..|.|....:||::.|....||......:..|:::.|..|.|.|||||:.|||.: ::
 Worm    41 PSNLSICNGIEYTQMRLPNILEHETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLMQMD 105

  Fly   119 RPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDLCV----AENTTSSASTAATP 178
            |.|.||:|||.:.:. ||..|..|.|.|||.|.|.||.   .:|:|:    .....:.:||..|.
 Worm   106 RLILPCKSLCMAVKQGCENRMANYGFPWPEMLSCEKFE---DDDMCIKPMQPAKPPAGSSTTCTA 167

  Fly   179 TRSVA 183
            ...||
 Worm   168 CSQVA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 44/117 (38%)
7tmF_FZD1_insect 236..568 CDD:320376
TM helix 1 245..270 CDD:320376
TM helix 2 279..300 CDD:320376
TM helix 3 338..364 CDD:320376
TM helix 4 381..397 CDD:320376
TM helix 5 419..448 CDD:320376
TM helix 6 468..495 CDD:320376
TM helix 7 527..552 CDD:320376
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:470581 44/122 (36%)
NTR_Sfrp1_like 162..283 CDD:239635 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.