DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and LOC1271960

DIOPT Version :10

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_061513840.1 Gene:LOC1271960 / 1271960 VectorBaseID:AGAMI1_011497 Length:1187 Species:Anopheles gambiae


Alignment Length:153 Identity:41/153 - (26%)
Similarity:63/153 - (41%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SGGGLMASSGTELDGLPH-----------HNRCEPITISICKNIPYNMTIMPNLIGHTKQEEAGL 85
            :|..::.:|.:.|.|...           ..:|||:.:..|:::.||:|..||..||...||...
Mosquito   465 TGDDIVGTSSSPLGGKDEVTVEIVTTARPPRKCEPLRLGYCRSVGYNVTTYPNFFGHGSLEEVEA 529

  Fly    86 EVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI--LERPI--PPCRSLCES------ARVCEKLMKT 140
            ::..|..||...|......|:|.|..|.|..  :|.|.  ..||..|:|      .|:.|:|.: 
Mosquito   530 DLISFRELVDAECFRQAFDFICRLLQPPCEYRSIEEPTAGTVCRQYCQSFWAGCGERLPERLRR- 593

  Fly   141 YNFNWPENLECSKFPVHGGEDLC 163
                   .|:|.:||...|...|
Mosquito   594 -------YLDCERFPESTGVQSC 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 37/123 (30%)
7tmF_FZD1_insect 236..568 CDD:320376
TM helix 1 245..270 CDD:320376
TM helix 2 279..300 CDD:320376
TM helix 3 338..364 CDD:320376
TM helix 4 381..397 CDD:320376
TM helix 5 419..448 CDD:320376
TM helix 6 468..495 CDD:320376
TM helix 7 527..552 CDD:320376
LOC1271960XP_061513840.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.