DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and sfrp5

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_571933.1 Gene:sfrp5 / 117510 ZFINID:ZDB-GENE-011108-2 Length:310 Species:Danio rerio


Alignment Length:129 Identity:54/129 - (41%)
Similarity:74/129 - (57%) Gaps:6/129 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER 119
            |..:.:|.|:.|....:|||:.|....|...:...:.||:...|..|.|:|||||:.|||  |:|
Zfish    56 PADLRLCYNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVC--LDR 118

  Fly   120 PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSV 182
            ||.|||||||:.| .|..:|:||.|.|||.|:|.|||:  ..|||:....::..:| .||...|
Zfish   119 PIYPCRSLCEAVRDSCAPVMETYGFPWPEMLQCEKFPI--DNDLCIPMQFSAGHAT-QTPVSKV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 50/112 (45%)
Frizzled 237..564 CDD:279827
sfrp5NP_571933.1 CRD_SFRP5 46..172 CDD:143553 50/119 (42%)
NTR_Sfrp1_like 177..302 CDD:239635 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.