DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz and LOC101884738

DIOPT Version :9

Sequence 1:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005174172.1 Gene:LOC101884738 / 101884738 -ID:- Length:292 Species:Danio rerio


Alignment Length:168 Identity:60/168 - (35%)
Similarity:85/168 - (50%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GGGLMASSGTELDGLPHHNRCEPI--TISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVK 95
            |.|.|.:...|..|.   :||.||  .:::|:.:.|:...||||:||....||..:...:.||:.
Zfish    14 GIGAMPNGHWEHQGT---SRCVPIPANMALCQGLGYSSMRMPNLLGHESPAEAVQQSTSWLPLLA 75

  Fly    96 IGCSDDLQLFLCSLYVPVCTILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGG 159
            ..|....::|||||:.|||  |||.|.||||||.|.| .|..:|..|.:.||..|:|.:||    
Zfish    76 RECHPHARIFLCSLFAPVC--LERIISPCRSLCVSVRDSCAPIMNCYGYPWPRILQCDQFP---- 134

  Fly   160 ED--LCVAENTTSSASTAATPTRSVAKVTTRKHQTGVE 195
            :|  :|:     ||.:.....|.:..:|..|...|..|
Zfish   135 KDHLMCI-----SSVANLQNGTSNEGRVVPRASCTDCE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 48/120 (40%)
Frizzled 237..564 CDD:279827
LOC101884738XP_005174172.1 CRD_FZ 29..166 CDD:295308 54/147 (37%)
NTR_Sfrp1_like 160..290 CDD:239635 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.