DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and NKX6-2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:198 Identity:65/198 - (32%)
Similarity:91/198 - (45%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 LDGSGKSLESPHGPPPGSHMQSTILS-PAALASGHVPIRPTPFSALAAAAVAWTG----MGGGVP 380
            |.|.|..|  |.|.|   |..|.||. |...|.|.:.......:.||::|..:.|    :..|.|
Human    45 LGGLGAQL--PLGTP---HGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYP 104

  Fly   381 -------------WPGTRQMPPFGPPGMFPGAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQ 432
                         |||..|..|:..|.:...|..||..:     |...:||.     |..|:.||
Human   105 KPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLD-----KDGKKKHS-----RPTFSGQQ 159

  Fly   433 LLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAK-----------AKRLQEAEIEK 486
            :.:|||.|.:.:||:..|||..:.||.:||:|||:||||||.|           ||:.|:::.||
Human   160 IFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEK 224

  Fly   487 IKM 489
            :|:
Human   225 LKV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/63 (43%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 13/52 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 7/32 (22%)
Homeobox 151..204 CDD:306543 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.