DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and HAT1

DIOPT Version :10

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:85 Identity:28/85 - (32%)
Similarity:41/85 - (48%) Gaps:17/85 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 FGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQV 465
            :||   |..|.|..|.|             .|...||..|:|...|:..::...:..|.||..||
plant   128 YGG---ETCRKKLRLSK-------------DQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQV 176

  Fly   466 KIWFQNRRAKAKRLQEAEIE 485
            ::|||||||:.| |::.|::
plant   177 EVWFQNRRARTK-LKQTEVD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeodomain 422..478 CDD:459649 18/55 (33%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:461370
HOX 134..188 CDD:197696 22/66 (33%)
HALZ 190..233 CDD:128634 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.