DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and HB17

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:86 Identity:29/86 - (33%)
Similarity:42/86 - (48%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 DANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIW 468
            |.:.|||.|..|             |.:|...||..||:...|:..::...:..|.|...|:::|
plant   132 DGSAPPRKKLRL-------------TREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVW 183

  Fly   469 FQNRRAKAKRLQ-EAEIEKIK 488
            ||||||::|..| |.|.|.:|
plant   184 FQNRRARSKLKQTEMECEYLK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 17/52 (33%)
HB17NP_178252.2 HOX 136..192 CDD:197696 22/68 (32%)
HALZ 194..237 CDD:128634 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.