DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and HB17

DIOPT Version :10

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:86 Identity:29/86 - (33%)
Similarity:42/86 - (48%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 DANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIW 468
            |.:.|||.|..|             |.:|...||..||:...|:..::...:..|.|...|:::|
plant   132 DGSAPPRKKLRL-------------TREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVW 183

  Fly   469 FQNRRAKAKRLQ-EAEIEKIK 488
            ||||||::|..| |.|.|.:|
plant   184 FQNRRARSKLKQTEMECEYLK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeodomain 422..478 CDD:459649 17/55 (31%)
HB17NP_178252.2 HOX 136..192 CDD:197696 22/68 (32%)
HALZ 194..237 CDD:128634 5/11 (45%)

Return to query results.
Submit another query.