DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Nkx6-3

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_083278.1 Gene:Nkx6-3 / 74561 MGIID:1921811 Length:262 Species:Mus musculus


Alignment Length:210 Identity:66/210 - (31%)
Similarity:87/210 - (41%) Gaps:60/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TPDGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPIRP--TPFSALAAAAVAWTGMGG-- 377
            :|.|| |...:..:|||       .:.|||           ||  ||.|:|.:......|.||  
Mouse    39 SPPGL-GPQLAAGTPHG-------ITDILS-----------RPVATPNSSLLSGYPHVAGFGGLS 84

  Fly   378 --GVPWPGTRQMPPFGPP-GMFPGAG-------------FGGD--------ANEPPRIKCNLRKH 418
              ||         .:||. |.|..||             .|.|        :|.|..:...:.|.
Mouse    85 SQGV---------YYGPQVGSFSKAGNEYPTRTRNCWADTGQDWRGSARPCSNTPDPLSDTIHKK 140

  Fly   419 KPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAE 483
            |   ..|..||..|:.:|||.|.:.:||:..|||..:.||.:||:|||:||||||.|.::....|
Mouse   141 K---HTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALE 202

  Fly   484 IEKIKMAALGRGAPG 498
            .......|.| ||.|
Mouse   203 PSSSTPRAPG-GASG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/52 (52%)
Nkx6-3NP_083278.1 Homeobox 143..197 CDD:395001 27/53 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..237 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.