DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Cdx2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:233 Identity:63/233 - (27%)
Similarity:93/233 - (39%) Gaps:71/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 GLDGSGKSLESPHGPPP--GSHMQSTILSPAALASGH-----------VPIRP-----TPFSALA 366
            ||:.:.::..||...|.  |.|:.:...:.|.|.|..           .|:|.     .|..|.|
  Rat    23 GLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPTAYGAPLREDWNGYAPGGAAA 87

  Fly   367 AAAVAWTGMGGGVPWPGTRQMPPF-------------------------------GPPGMFPGAG 400
            |.||| .|:.||.|........|.                               ||||  |.|.
  Rat    88 ANAVA-HGLNGGSPAAAMGYSSPAEYHAHHHPHHHPHHPAAAPSCASGLLQTLNPGPPG--PAAT 149

  Fly   401 FGGDANEPPRIKCNLRKHKPNRKPRTP-----------------FTTQQLLSLEKKFREKQYLSI 448
            ...:...|...:.||.:..  |||..|                 :|..|.|.|||:|...:|::|
  Rat   150 AAAEQLSPSGQRRNLCEWM--RKPAQPSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITI 212

  Fly   449 AERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIEK 486
            ..:||.:::|.|:|.||||||||||||.:::.:.::::
  Rat   213 RRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/69 (41%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 33/151 (22%)
Homeobox 189..241 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.