DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and msx2a

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001025440.1 Gene:msx2a / 573620 ZFINID:ZDB-GENE-980526-322 Length:257 Species:Danio rerio


Alignment Length:86 Identity:70/86 - (81%)
Similarity:78/86 - (90%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 NEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQ 470
            ::.|.| |.|||||.||||||||||.|||:||:|||:||||||||||||||||.|||||||||||
Zfish   108 SQSPTI-CPLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQ 171

  Fly   471 NRRAKAKRLQEAEIEKIKMAA 491
            |||||||||||||:|:.|||:
Zfish   172 NRRAKAKRLQEAELERFKMAS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 47/52 (90%)
msx2aNP_001025440.1 Homeobox 125..178 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592935
Domainoid 1 1.000 106 1.000 Domainoid score I6491
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm25138
orthoMCL 1 0.900 - - OOG6_109202
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.