DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Noto

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:217 Identity:59/217 - (27%)
Similarity:83/217 - (38%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LESPHGPP--PGSHMQSTILSPAALA-SGHVP------------------IRP--TPFSALAAAA 369
            :.||...|  .|:.:|...|.|..:| |..||                  .||  ...||.:...
  Rat     1 MSSPVPQPASSGTQVQPGDLGPCPVAVSPVVPNHLARGRLESSFSVEAILARPETREHSATSLPL 65

  Fly   370 VAWTGMGGG-------VPW---PGTRQMPPFGPPGMFPGAGFG---------------------- 402
            ...|.:..|       :||   .|| .:|.:...|::|.....                      
  Rat    66 STCTSLNFGSVSQYQVLPWVCSTGT-WLPTYLSVGIYPMCSMSCMPGLNVTHLFCQQGLRLTGSE 129

  Fly   403 -----GDANEPPRIKCNLRKHKPNR---KPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLR 459
                 |.....|.:  ||:.|...|   :.||.|:.|||..|||.|.::..|...|||:.::.|.
  Rat   130 LPSCLGPLKRAPTV--NLQDHNTERHQKRVRTMFSEQQLGELEKVFAKQHNLVGKERAQLAARLH 192

  Fly   460 LTETQVKIWFQNRRAKAKRLQE 481
            |||.||:|||||||.|.::.|:
  Rat   193 LTENQVRIWFQNRRVKYQKQQK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/52 (54%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.