DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Emx2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001102639.1 Gene:Emx2 / 499380 RGDID:1564797 Length:253 Species:Rattus norvegicus


Alignment Length:228 Identity:73/228 - (32%)
Similarity:91/228 - (39%) Gaps:68/228 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 IEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSP---------AALASGH------ 354
            ||.:.|.|||      |..|..  |.|..|...|:..|:.::|         ||.|:|.      
  Rat    12 IESLVAKDSP------LPASRS--EDPIRPAALSYANSSPINPFLNGFHSAAAAAAAGRGVYSNP 68

  Fly   355 ---------------VPIRPT-PFSALAAAAVAWTGMGGGVPWPGTRQMPPF------GPPGMFP 397
                           ||:.|. |..||||.           |.|.:....|.      .|...:|
  Rat    69 DLVFAEAVSHPPNPAVPVHPVPPPHALAAH-----------PLPSSHSPHPLFASQQRDPSTFYP 122

  Fly   398 ---------GAGFGGDANEPPR-IKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERA 452
                     |..|.|:...|.. :..|....||.| .||.|:..|||.||..|.:..|:..|||.
  Rat   123 WLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKR-IRTAFSPSQLLRLEHAFEKNHYVVGAERK 186

  Fly   453 EFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIE 485
            :.:.||.|||||||:||||||.|.|| |:.|.|
  Rat   187 QLAHSLSLTETQVKVWFQNRRTKFKR-QKLEEE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
Emx2NP_001102639.1 Homeobox 159..212 CDD:395001 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.