DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001008061.1 Gene:dlx2 / 493423 XenbaseID:XB-GENE-852891 Length:285 Species:Xenopus tropicalis


Alignment Length:191 Identity:61/191 - (31%)
Similarity:98/191 - (51%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 DSIVDIEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSP-----AALASGHVPIRP 359
            ||:|  .||:::..|.|:...|.   ||.|||..|...:...|...:.     ....|.:..:..
 Frog     6 DSLV--ADMHSNHMPSSSYHSLH---KSQESPTLPVSTATDSSYYTNQQQQQHCGAGSPYGQLGS 65

  Fly   360 TPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDANEP------PRIKCNLRKH 418
            ..|...|...::::.....:.:.|:  ...:||.|..|..    ..|:|      |.::....|.
 Frog    66 YQFHGAALNGISYSTKSYDLTYSGS--YSSYGPYGTSPSP----PHNDPEKEDCEPEVRMVNGKP 124

  Fly   419 KPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL 479
            |..|||||.:::.||.:|:::|::.|||::.||||.::||.||:|||||||||||:|.|::
 Frog   125 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 30/52 (58%)
dlx2NP_001008061.1 DLL_N 29..107 CDD:315147 13/83 (16%)
Homeobox 130..183 CDD:306543 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.