DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and nkx6.1

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001002475.1 Gene:nkx6.1 / 436748 ZFINID:ZDB-GENE-040718-178 Length:312 Species:Danio rerio


Alignment Length:305 Identity:92/305 - (30%)
Similarity:121/305 - (39%) Gaps:103/305 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 NSPP--ASTSSTPSSTPLGSA--LGSQGNVASTPAKNERHSPLGSHTDSELEYDEEMLQDHEADH 295
            |:||  |..|.|...|||..|  |.|.|..:||       ||..:                    
Zfish    18 NTPPLAALHSMTEMKTPLYPAYPLSSTGPASST-------SPTAT-------------------- 55

  Fly   296 DEEEDSIVDIEDMNADDSPRSTPDGLDGSGKS---------LESPHGPPPGSHMQSTILSPAALA 351
                       ..|....|.|:|.....||.|         :.:|||........|...|||.:.
Zfish    56 -----------SPNPGGIPVSSPGIKTSSGLSALASAQQCAIATPHGINDILSRPSVACSPAGIL 109

  Fly   352 SGHVP----IRPTP-----FSALAAA-AVA-----WTGMGGGVP--WPGTRQMPPFGPPGMFPGA 399
            || :|    :.|.|     ||..||| |||     .|.:.|..|  |||..|.|.:         
Zfish   110 SG-LPRFSSLSPPPPPGLYFSPSAAAVAVARYPKPLTELPGRTPIFWPGVMQSPHW--------- 164

  Fly   400 GFGGDANEPPRIKCN-------LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSS 457
               .||    |..|:       |.|....:..|..|:.||:.:|||.|.:.:||:..|||..:.|
Zfish   165 ---RDA----RFACSPHQNSVLLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYS 222

  Fly   458 LRLTETQVKIWFQNRRAK-----------AKRLQEAEIEKIKMAA 491
            |.:||:|||:||||||.|           ||:.|::|.|::|.|:
Zfish   223 LGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSETERLKGAS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/63 (43%)
nkx6.1NP_001002475.1 Homeobox 189..242 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.