DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and cdx1a

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:197 Identity:52/197 - (26%)
Similarity:87/197 - (44%) Gaps:49/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PGSHMQSTILSPAALASGHVPIRPT-PF-------------SALAAAAVAWT---GMGGGVPWP- 382
            |..|:.        |:..|:.:.|: |:             :.|.....:|:   |.|....|| 
Zfish    15 PARHLN--------LSQPHLNVYPSAPYPDYSGYHPGPALGNDLHHTGSSWSPGFGPGSRDDWPP 71

  Fly   383 ----GT-RQMP---------PFGPPGMFPGAGFGGDANEPPR-IKCNLRKHKPNRKPRTP----- 427
                || ..:|         |....|:..||..  |..||.. ::.:.....|..|.||.     
Zfish    72 LYGHGTGHSLPANGVEVSVLPSVDQGLLSGAPV--DREEPQDWMRRSAVPTNPGGKTRTKDKYRV 134

  Fly   428 -FTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIEKIKMAA 491
             ::..|.|.|||:|...:|::|..:||.:.:|.|:|.||||||||||||.:::.:..:::::.::
Zfish   135 VYSDVQRLELEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNKKRLQQVQQSS 199

  Fly   492 LG 493
            .|
Zfish   200 SG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/58 (47%)
cdx1aNP_998001.2 Caudal_act 11..115 CDD:282574 22/109 (20%)
COG5576 <122..227 CDD:227863 30/80 (38%)
Homeobox 133..185 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.