Sequence 1: | NP_477324.1 | Gene: | Dr / 45285 | FlyBaseID: | FBgn0000492 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998001.2 | Gene: | cdx1a / 405762 | ZFINID: | ZDB-GENE-050510-1 | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 52/197 - (26%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 49/197 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 336 PGSHMQSTILSPAALASGHVPIRPT-PF-------------SALAAAAVAWT---GMGGGVPWP- 382
Fly 383 ----GT-RQMP---------PFGPPGMFPGAGFGGDANEPPR-IKCNLRKHKPNRKPRTP----- 427
Fly 428 -FTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIEKIKMAA 491
Fly 492 LG 493 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dr | NP_477324.1 | Homeobox | 424..477 | CDD:278475 | 27/58 (47%) |
cdx1a | NP_998001.2 | Caudal_act | 11..115 | CDD:282574 | 22/109 (20%) |
COG5576 | <122..227 | CDD:227863 | 30/80 (38%) | ||
Homeobox | 133..185 | CDD:278475 | 25/51 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |