DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and cdx4

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_989417.1 Gene:cdx4 / 395056 XenbaseID:XB-GENE-482787 Length:260 Species:Xenopus tropicalis


Alignment Length:163 Identity:48/163 - (29%)
Similarity:68/163 - (41%) Gaps:46/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 GPPPGSHMQSTILSPAALA---SGHVPIRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPG 394
            ||...:..||:.|||...|   ||:....|:....|.:..::.|.                    
 Frog    78 GPSNTNMAQSSDLSPNQFAYNSSGYSSPHPSGTGILHSVDLSHTA-------------------- 122

  Fly   395 MFPGAGFGGDANEPPRIKCN-------------LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYL 446
                      ||.|..:..|             ..|.:...|.|..:|..|.|.|||:|...:|:
 Frog   123 ----------ANSPSDLSQNSYEWMGKTVQSTSTGKTRTKEKYRVVYTDHQRLELEKEFHYSRYI 177

  Fly   447 SIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL 479
            :|..:.|.::||||:|.||||||||||||.::|
 Frog   178 TIRRKTELAASLRLSERQVKIWFQNRRAKERKL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/52 (54%)
cdx4NP_989417.1 Caudal_act 16..139 CDD:282574 17/90 (19%)
Homeobox 156..208 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.