DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and cdx1

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_989416.1 Gene:cdx1 / 395055 XenbaseID:XB-GENE-485396 Length:262 Species:Xenopus tropicalis


Alignment Length:176 Identity:49/176 - (27%)
Similarity:78/176 - (44%) Gaps:55/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 PHGPPPGSHMQSTILSPAALA---SGHVPIRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGP 392
            |:||.||    ::..:||.::   |.:.|::|                      ||...:||...
 Frog    74 PYGPGPG----ASSANPAQISFSPSDYNPVQP----------------------PGPGLLPPSLN 112

  Fly   393 PGMFP-----------------GAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKF 440
            ..:.|                 |.....::|...|.|         .|.|..:|..|.|.|||:|
 Frog   113 SSVSPLSPSAQRRNLYEWMRRTGVPTSTNSNGKTRTK---------DKYRVVYTDHQRLELEKEF 168

  Fly   441 REKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIEK 486
            ...:|::|..:||.::||.|||.||||||||||||.:::.:.::::
 Frog   169 HYSRYITIRRKAELAASLALTERQVKIWFQNRRAKERKVNKKKMQQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
cdx1NP_989416.1 Caudal_act 13..133 CDD:282574 15/84 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..120 15/71 (21%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 152..173 8/20 (40%)
Homeobox 153..205 CDD:278475 29/51 (57%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 191..202 9/10 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..262 1/12 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.