DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and msx2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_002936749.1 Gene:msx2 / 394987 XenbaseID:XB-GENE-852974 Length:256 Species:Xenopus tropicalis


Alignment Length:214 Identity:101/214 - (47%)
Similarity:113/214 - (52%) Gaps:36/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSP----AALASGHVPIRPTPFSALAAAAVAWT 373
            |||...:.|....:....|...|...|.......|    |.:|...||........:.|:|    
 Frog     3 SPRKIKEDLSSDEEGQVHPTLSPSDDHKIKVSSLPFSVEALMADKRVPKEAPHLRGVDASA---- 63

  Fly   374 GMGGGVP---WPGTRQMPPFGPPGM---FPGAGF--------------GGDANEPPR----IKCN 414
              .|..|   ..|.|..|  .|||:   |..:..              ||..:.|||    ..|.
 Frog    64 --AGSTPRHLHMGIRDSP--SPPGLTKTFETSSVKSENSEDGTTWSKDGGSYSPPPRHLSPSTCT 124

  Fly   415 LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL 479
            |||||.||||||||||.|||:||:|||:||||||||||||||||.||||||||||||||||||||
 Frog   125 LRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL 189

  Fly   480 QEAEIEKIKMAALGRGAPG 498
            |||||||:||||.....||
 Frog   190 QEAEIEKLKMAAKPILPPG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 47/52 (90%)
msx2XP_002936749.1 Homeobox 134..188 CDD:365835 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6430
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm48229
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2894
SonicParanoid 1 1.000 - - X657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.