DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and msx1

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001032329.1 Gene:msx1 / 394692 XenbaseID:XB-GENE-490378 Length:275 Species:Xenopus tropicalis


Alignment Length:264 Identity:107/264 - (40%)
Similarity:120/264 - (45%) Gaps:91/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 IEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSP--AALASGHVPIRP-------- 359
            :|.:.||..|        |..:.|.||.|.|    :..|..||  .:||.|..|..|        
 Frog    48 VEALMADRKP--------GRERDLSSPTGSP----LAGTSHSPRVGSLAPGETPNSPISIGNRFP 100

  Fly   360 ------TPFSAL----AAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDANEPPRIKCN 414
                  .|..||    :....:|.......|.|..|..||                      .|.
 Frog   101 VGGIMKLPEEALVKPESPERSSWIQSPRFSPSPTRRMSPP----------------------ACT 143

  Fly   415 LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL 479
            |||||.||||||||||.|||:||:|||:||||||||||||||||.||||||||||||||||||||
 Frog   144 LRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL 208

  Fly   480 QEAEIEKIKMAA-------------LGRGAP---------------------GAQWAMAGYFHPS 510
            ||||:||:||||             ||...|                     |...|..||   |
 Frog   209 QEAELEKLKMAAKPMLPPAFGISFPLGTPVPTASLYGTSNPFQRPALPVSPMGLYTAHVGY---S 270

  Fly   511 LMHL 514
            :.||
 Frog   271 MYHL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 47/52 (90%)
msx1NP_001032329.1 PTZ00449 <55..>259 CDD:185628 97/237 (41%)
Homeobox 153..207 CDD:365835 48/53 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6430
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm48229
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X657
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.