DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Noto

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:217 Identity:58/217 - (26%)
Similarity:86/217 - (39%) Gaps:65/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LESPHGPPPGSHMQSTILSPA-ALASGHVPIR------PTPFSALAAAA------VAWTGMG--- 376
            :.||  .|.|:.:|...|.|. ...|..||.|      .:.||..|..|      :|.|.:.   
Mouse     1 MSSP--APSGTQVQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLPLST 63

  Fly   377 -------------GGVPW---PGTRQMPPFGPPGMFPGAGFG----------------------- 402
                         |.:||   .|: .:|.:...|::|.....                       
Mouse    64 CTSLNLLGAVSQYGVLPWVCSTGS-WLPAYLSVGVYPLCSMSCVPGLNVTHHQQGLRLTGSELPY 127

  Fly   403 --GDANEPPRIKCNLRKH---KPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTE 462
              |.....|.:  :||.|   :..::.||.|..|||..|||.|.::..|...|||:.::.|.|||
Mouse   128 CLGPLKWAPTV--DLRDHGTERHTKRVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTE 190

  Fly   463 TQVKIWFQNRRAKAKRLQEAEI 484
            .||:|||||||.|.::.|:.::
Mouse   191 NQVRIWFQNRRVKYQKQQKLKL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/52 (54%)
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 7/21 (33%)
Homeobox 153..204 CDD:278475 27/50 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.