DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Dll

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:239 Identity:78/239 - (32%)
Similarity:107/239 - (44%) Gaps:55/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 MNADDSPRSTPDGLDGSGKSLE-SPHGPPPGSHMQSTILSPAALASGHVPIR------------- 358
            |:|.|:|. ||..:||...:.. :|....||......:...|  |:|:..||             
  Fly     1 MDAPDAPH-TPKYMDGGNTAASVTPGINIPGKSAFVELQQHA--AAGYGGIRSTYQHFGPQGGQD 62

  Fly   359 ---PTPFSALAAAAVAWTGMGGGVPWPGTRQ-----------MPPFGPPGMFPGAGFG-GDANEP 408
               |:|.|||            |.|:|...|           .||...|   |...|. .|..|.
  Fly    63 SGFPSPRSAL------------GYPFPPMHQNSYSGYHLGSYAPPCASP---PKDDFSISDKCED 112

  Fly   409 PRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRR 473
            ..::.| .|.|..|||||.:::.||..|.::|:..|||::.||||.::||.||:|||||||||||
  Fly   113 SGLRVN-GKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRR 176

  Fly   474 AKAKRLQEAEIEKIKMAA--LGRGAPGAQWAMAGYFHPSLMHLG 515
            :|.|::.:|.......:.  ||.|.|.     .|...|:.||.|
  Fly   177 SKYKKMMKAAQGPGTNSGMPLGGGGPN-----PGQHSPNQMHSG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 30/52 (58%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.