DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx3b

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:202 Identity:60/202 - (29%)
Similarity:90/202 - (44%) Gaps:54/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 SGHVPIRPTPFSALAAAAVAWTGMG---------GGVPWPGTRQMPPF---------GPPGMFPG 398
            ||.:...||...:......:.|.||         ...|:|  :||..:         ..||.:|.
Zfish    18 SGSMSCHPTSKDSPTLPESSATDMGYYSSHHEYYQSPPYP--QQMNSYHQFNLSGMGATPGAYPT 80

  Fly   399 ------------AGFGGDANEPPR----------IKCNLRKHKPNRKPRTPFTTQQLLSLEKKFR 441
                        ..:..|...||:          ::....|.|..|||||.:::.||.:|:::|:
Zfish    81 KTEYPYNTYRQYGHYNRDLQTPPQSAVKEEPETEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQ 145

  Fly   442 EKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQ---EAEIEKIKMAALGRGAPGAQWAM 503
            :.|||::.||||.::.|.||:|||||||||||:|.|:|.   |..:|.         :|.|..:|
Zfish   146 KAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEH---------SPNASDSM 201

  Fly   504 AGYFHPS 510
            |....||
Zfish   202 ACNSPPS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/22 (23%)
DLL_N 28..104 CDD:289198 12/77 (16%)
Homeobox 128..181 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.