DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx4b

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:239 Identity:69/239 - (28%)
Similarity:105/239 - (43%) Gaps:51/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EDMNADDSPR-----------STPDGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPI-- 357
            :.:|:.|..:           |....|.|...::...||...|.|:|.....|::......|:  
Zfish     9 DTLNSSDPSKSAFLEFGHGLASNQQHLSGFAHNIYPVHGLHSGGHLQHDAPYPSSAPHYSRPLGY 73

  Fly   358 -RPTPFSALAAAAVAWTGMGGGVPWPGTRQMP--PFGPPGMFPGAGFGGDANEPP------RIKC 413
             .|.|.||.|               ||. .||  |....|...........:|.|      .|:.
Zfish    74 AYPGPVSAAA---------------PGA-YMPYQPNNHSGALAHTRAEDTNHEKPAVIENGEIRL 122

  Fly   414 NLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKR 478
            | .|.|..|||||.:::.||.:|.::|::.|||::.|||:.::.|.||:|||||||||:|:|.|:
Zfish   123 N-GKGKKIRKPRTIYSSVQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKK 186

  Fly   479 LQE-----AEIEKIKMAALGRGAPGAQ--W--AMAGY---FHPS 510
            :.:     .|.|.:..::....:||..  |  :||..   .|||
Zfish   187 IMKHGSSGPEGELLHTSSSSPCSPGLSQLWEVSMANKVPPMHPS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/52 (52%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.