DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx2a

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:133 Identity:51/133 - (38%)
Similarity:72/133 - (54%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 FGPPGMFPGAGFGGDANEP-----------PRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREK 443
            |||.|.:      |..:.|           |.|:....|.|..|||||.:::.||.:|:::|::.
Zfish    91 FGPYGTY------GSCSSPTPADAEKEESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKT 149

  Fly   444 QYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL-QEAEIEKIKMAALGRGAPGAQWAMAGYF 507
            |||::.||||.::||.||:|||||||||||:|.|:| :..||...:..|.....|          
Zfish   150 QYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKSGEIPPEQHVASSESPP---------- 204

  Fly   508 HPS 510
            |||
Zfish   205 HPS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 30/52 (58%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:289198 6/21 (29%)
Homeobox 130..183 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.