DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx1a

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571380.1 Gene:dlx1a / 30568 ZFINID:ZDB-GENE-990415-48 Length:252 Species:Danio rerio


Alignment Length:209 Identity:67/209 - (32%)
Similarity:101/209 - (48%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PDGLDG--SGKSLESPHGPPPGSHMQSTILSPAALASGHVPI-------RPTPFSALAAAAVAWT 373
            |:.|:.  ||||:....|||      |..:||:::..||..:       .|...||.:.|    .
Zfish     7 PESLNSPVSGKSVFMEFGPP------SQQMSPSSMTHGHYSMHCLHSSGHPQHDSAYSPA----P 61

  Fly   374 GMGGGVPWP-----GTRQMPPF-GPPGMFP-GAGFGGDANEPP-------------RIKCNLRKH 418
            .....:|:|     |:....|: .....:| .:.......|.|             .::.| .|.
Zfish    62 SFPRSLPYPYVNSVGSHSSSPYLSTVQTYPNNSALAQTRLEDPAPESEKNTVVEGGEVRFN-GKG 125

  Fly   419 KPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAE 483
            |..|||||.:::.||.:|.::|::.|||::.||||.::||.||:|||||||||:|:|.|:|.:..
Zfish   126 KKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQG 190

  Fly   484 IEKIKMAAL--GRG 495
            ...|...||  |||
Zfish   191 GGTIDTNALANGRG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
dlx1aNP_571380.1 COG5576 <124..233 CDD:227863 41/81 (51%)
Homeobox 131..184 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.