DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and msx2b

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571351.3 Gene:msx2b / 30531 ZFINID:ZDB-GENE-980526-492 Length:241 Species:Danio rerio


Alignment Length:224 Identity:94/224 - (41%)
Similarity:114/224 - (50%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 ERHSPLGSHTDSELEYDEEMLQDHEADHDEEEDSIVDIEDMNADDSPRSTPDGLDGSGKSLESPH 332
            :|.:.:.||..|.    |.::..|:.:.|.|...    ||:::..:.....|....:|       
Zfish    18 QRKTQVSSHPFSV----ESLISSHKTNKDFERRR----EDVSSQFAQTEIRDSCGSAG------- 67

  Fly   333 GPPPGSHMQSTILSPAALASGHVPIRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFP 397
              .|...|..|  ||....|      |.|..     ..:|. |..  .:..|||..|        
Zfish    68 --IPKHFMLQT--SPVKSES------PEPDD-----CTSWV-MNS--RYSQTRQESP-------- 106

  Fly   398 GAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTE 462
                           |.|||||.||||||||||.|||:||:|||:||||||||||||||||.|||
Zfish   107 ---------------CPLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLTLTE 156

  Fly   463 TQVKIWFQNRRAKAKRLQEAEIEKIKMAA 491
            |||||||||||||||||||||:||:|:.|
Zfish   157 TQVKIWFQNRRAKAKRLQEAELEKLKLTA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 47/52 (90%)
msx2bNP_571351.3 Homeobox 118..171 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592937
Domainoid 1 1.000 106 1.000 Domainoid score I6491
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm25138
orthoMCL 1 0.900 - - OOG6_109202
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2894
SonicParanoid 1 1.000 - - X657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.