DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and msx1a

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_571348.1 Gene:msx1a / 30527 ZFINID:ZDB-GENE-980526-312 Length:233 Species:Danio rerio


Alignment Length:209 Identity:91/209 - (43%)
Similarity:105/209 - (50%) Gaps:55/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 EMLQDHEADHDEEEDSIV--DIEDMNADDSP-RSTPDGLDGSGKSLESPHGPPPGSHMQSTILSP 347
            ||........|.:...|:  .:|.:.||..| |.:||.....|.|:|                  
Zfish    25 EMQTRVTVQEDAQRPKILPFSVEALMADRRPNRGSPDADARLGFSVE------------------ 71

  Fly   348 AALASGHVPIRPTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDANEPPRIK 412
                     :...|..|.:.....|.                       |.|.|......||  .
Zfish    72 ---------VLQLPVKAESPERSTWV-----------------------PRARFSPSRLSPP--A 102

  Fly   413 CNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAK 477
            |.|||||.||||||||:|.|||:||:|||:||||||||||||||||.||||||||||||||||||
Zfish   103 CPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAK 167

  Fly   478 RLQEAEIEKIKMAA 491
            ||||||:||:||||
Zfish   168 RLQEAELEKLKMAA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 46/52 (88%)
msx1aNP_571348.1 Homeobox 114..167 CDD:278475 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592938
Domainoid 1 1.000 106 1.000 Domainoid score I6491
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm25138
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2894
SonicParanoid 1 1.000 - - X657
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.