DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Dlx5

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_037075.1 Gene:Dlx5 / 25431 RGDID:2506 Length:289 Species:Rattus norvegicus


Alignment Length:209 Identity:61/209 - (29%)
Similarity:96/209 - (45%) Gaps:57/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 ADHDEEEDSIVDIEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPI 357
            |.|...::| ..:.:.:|.||...:|.|        .:|||          ..||.: ||....:
  Rat    26 AMHHPSQES-PTLPESSATDSDYYSPAG--------AAPHG----------YCSPTS-ASYRKAL 70

  Fly   358 RPTPF-------SALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDAN-------EP 408
            .|..:       ||....|.|:...|...|:                 ..:||..|       :|
  Rat    71 NPYQYQYHSVNGSAAGYPAKAYADYGYASPY-----------------HQYGGAYNRVPSATSQP 118

  Fly   409 ------PRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKI 467
                  |.::....|.|..|||||.:::.||.:|:::|::.|||::.||||.::||.||:|||||
  Rat   119 EKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKI 183

  Fly   468 WFQNRRAKAKRLQE 481
            ||||:|:|.|::.:
  Rat   184 WFQNKRSKIKKIMK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
Dlx5NP_037075.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 6/23 (26%)
DLL_N 32..118 CDD:289198 23/122 (19%)
Homeobox 140..193 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 61/209 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.