DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Vax1

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:196 Identity:59/196 - (30%)
Similarity:84/196 - (42%) Gaps:65/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 GMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDANEPP-----------RI-----KCNLRK----- 417
            |..|.:|....::     |.|.|.|:|...|.|:..           ||     |.::|:     
Mouse    34 GAEGSLPAAFLKE-----PQGAFSGSGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPK 93

  Fly   418 ----HKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKR 478
                .:|.| .||.||.:||..||.:|:..||:...||.|.:..|.|:|||||:||||||.|.|:
Mouse    94 GLDLDRPKR-TRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 157

  Fly   479 LQ--EAEIEKI-----------KMAALGR----------------GAPGAQWAMAGYFHPSLMHL 514
            .|  ::|:..:           ::...||                ||.|:  |:.|   |||..|
Mouse   158 DQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGS--ALRG---PSLPAL 217

  Fly   515 G 515
            |
Mouse   218 G 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/52 (54%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 10/39 (26%)
Homeobox 103..156 CDD:306543 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.