Sequence 1: | NP_477324.1 | Gene: | Dr / 45285 | FlyBaseID: | FBgn0000492 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004088.2 | Gene: | EMX1 / 2016 | HGNCID: | 3340 | Length: | 290 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 76/233 - (32%) |
---|---|---|---|
Similarity: | 96/233 - (41%) | Gaps: | 74/233 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 305 IEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPIRPT------PFS 363
Fly 364 A---------LAAAAVAWTGMGGG--VPWPGTRQMP-------------PFGPPGMFPGA----- 399
Fly 400 -------------GFGGDANEPPRIKCNLRKHKP-NRKP---RTPFTTQQLLSLEKKFREKQYLS 447
Fly 448 IAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIE 485 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dr | NP_477324.1 | Homeobox | 424..477 | CDD:278475 | 29/55 (53%) |
EMX1 | NP_004088.2 | COG5576 | 140..>251 | CDD:227863 | 45/113 (40%) |
Homeobox | 196..248 | CDD:278475 | 28/51 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 216..257 | 24/41 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |