DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and vab-15

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_509648.1 Gene:vab-15 / 181197 WormBaseID:WBGene00006881 Length:225 Species:Caenorhabditis elegans


Alignment Length:244 Identity:96/244 - (39%)
Similarity:126/244 - (51%) Gaps:58/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DHDEEEDSIVDIEDM-------NADDSPRSTPDGLDGSGKSLESPHGPP--PGSHMQSTI----L 345
            |...::..:..:|.:       ..:|.|:.||          .:|..|.  ||.|..:..    |
 Worm     5 DEKPKQSGLFSVESLLETPKQKCREDLPKPTP----------ITPKTPMLIPGLHPMTPYFGAQL 59

  Fly   346 SPA----ALASGHVPIRPTPFSALAAAAVAWTGMGGGVPW-PGTRQMPPFGPPGMFPGAGFGGDA 405
            .|.    |.....:||..:. |:..:.|.:...|...:.| ...|:..|               .
 Worm    60 DPVMIYFAQTGNRLPIVSSD-SSPESCASSPLSMQHSLQWLSSQREDSP---------------T 108

  Fly   406 NEPPRI-----KCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQV 465
            ::..:|     ||.|||||.||||||||:||||:|||:||:.|||||||||||||:||:||||||
 Worm   109 SDDAKIQIGLSKCMLRKHKNNRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQV 173

  Fly   466 KIWFQNRRAKAKRLQEAEIEKIKM--------AALGRGAPGAQWAMAGY 506
            ||||||||||:|||||||:||:|.        ||:| |||.....:|.|
 Worm   174 KIWFQNRRAKSKRLQEAEVEKVKFAQASAYAAAAVG-GAPDPSSILAFY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 45/52 (87%)
vab-15NP_509648.1 Homeobox 132..185 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167909
Domainoid 1 1.000 103 1.000 Domainoid score I4285
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - oto19663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2894
SonicParanoid 1 1.000 - - X657
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.