DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Msx2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:228 Identity:103/228 - (45%)
Similarity:121/228 - (53%) Gaps:61/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 DEEEDSIVDIEDMNADDSPRSTPDGLDGSGK-------SL---------------ESPHGPP--- 335
            |||..:::        ..|...|.|.:||.:       ||               |||..||   
Mouse    14 DEEGPAVL--------AGPGPGPGGAEGSAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCA 70

  Fly   336 -PGSHMQSTILSPAALASGHVP---IRPTPFSALAAAAVAWTGMGGGVPW---PGTRQMPPFGPP 393
             .|:.::..:|....:...|.|   ::|     ...|:|.......|.||   || |..||  |.
Mouse    71 SAGAVLRPLLLPGHGVRDAHSPGPLVKP-----FETASVKSENSEDGAPWIQEPG-RYSPP--PR 127

  Fly   394 GMFPGAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSL 458
            .|.|             ..|.|||||.||||||||||.|||:||:|||:||||||||||||||||
Mouse   128 HMSP-------------TTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSL 179

  Fly   459 RLTETQVKIWFQNRRAKAKRLQEAEIEKIKMAA 491
            .||||||||||||||||||||||||:||:||||
Mouse   180 NLTETQVKIWFQNRRAKAKRLQEAELEKLKMAA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 47/52 (90%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 12/43 (28%)
Homeobox 145..198 CDD:306543 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847592
Domainoid 1 1.000 107 1.000 Domainoid score I6513
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm43098
orthoMCL 1 0.900 - - OOG6_109202
Panther 1 1.100 - - O PTHR24338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2894
SonicParanoid 1 1.000 - - X657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.