DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and DLX2

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:310 Identity:84/310 - (27%)
Similarity:121/310 - (39%) Gaps:104/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 STSSTPSST-------PLGSALGSQGNVASTPAKNERHS----PLGSHTDSELEYDEEMLQDHEA 293
            ||....|||       |.|...|..||.:|:.:.::...    |:.:.|||....:    |.|  
Human    14 STQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTN----QQH-- 72

  Fly   294 DHDEEEDSIVDIEDMNADDSPRSTPDGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPIR 358
                                    |.|..|.|.|        |.:||.|....    |||   :.
Human    73 ------------------------PAGGGGGGGS--------PYAHMGSYQYQ----ASG---LN 98

  Fly   359 PTPFSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFGGDANEP------PRIKCNLRK 417
            ..|:||.::..:.:|.........||...|.               .|||      |.|:....|
Human    99 NVPYSAKSSYDLGYTAAYTSYAPYGTSSSPA---------------NNEPEKEDLEPEIRIVNGK 148

  Fly   418 HKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL-QE 481
            .|..|||||.:::.||.:|:::|::.|||::.||||.::||.||:|||||||||||:|.|:: :.
Human   149 PKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKS 213

  Fly   482 AEIEK--------------------------IKMAALGRGAPGAQWAMAG 505
            .||..                          :.....|.|.||:..:.||
Human   214 GEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 30/52 (58%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 18/94 (19%)
DLL_N 51..132 CDD:289198 25/140 (18%)
Homeobox 155..208 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 8/53 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.