DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and NKX6-3

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:215 Identity:63/215 - (29%)
Similarity:90/215 - (41%) Gaps:61/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 TPDGLDGSGKSLESPHGPPPGSHMQSTILS-PAA-----LASGHVPIRPTPFSALAAAAVAWTGM 375
            :|.|| |...:..:|||       .:.||| |.|     |.||:..:  ..|..|::..|.::..
Human    39 SPPGL-GPQLAAGTPHG-------ITDILSRPVAAPNNSLLSGYPHV--AGFGGLSSQGVYYSPQ 93

  Fly   376 GG--------------------GVPWPGTRQMPPFGPPGMFPGAGFGGDANEPPRIKCNLRKHKP 420
            .|                    |..|.|.||.                 :|.|..:..::.|.| 
Human    94 VGNFSKAGNEYPTRTRNCWADTGQDWRGGRQC-----------------SNTPDPLSDSIHKKK- 140

  Fly   421 NRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIE 485
              ..|..||..|:.:|||.|.:.:||:..|||..:.||.:||:|||:||||||.|.::....|  
Human   141 --HTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALE-- 201

  Fly   486 KIKMAALGRGAPGAQWAMAG 505
              ..::..| |||...|.||
Human   202 --PSSSTPR-APGGAGAGAG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 27/52 (52%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.