DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Dlx5

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:171 Identity:60/171 - (35%)
Similarity:88/171 - (51%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 SLESPHGPPPGSHMQSTILSPAALASGHVPIRPTPFS---ALAAAAVAWTGMGGGVPWPGTRQMP 388
            |.||| ..|..|...|...|||. |:.|....||..|   ||......:.|:.|.......:...
Mouse    31 SQESP-TLPESSATDSDYYSPAG-AAPHGYCSPTSASYGKALNPYQYQYHGVNGSAAGYPAKAYA 93

  Fly   389 PFGPPGMFPGAGFGGDAN-------EP------PRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKF 440
            .:|...  |...:||..|       :|      |.::....|.|..|||||.:::.||.:|:::|
Mouse    94 DYGYAS--PYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRF 156

  Fly   441 REKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQE 481
            ::.|||::.||||.::||.||:|||||||||:|:|.|::.:
Mouse   157 QKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 7/18 (39%)
DLL_N 32..118 CDD:403572 23/89 (26%)
Homeobox 140..194 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 60/171 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.