Sequence 1: | NP_477324.1 | Gene: | Dr / 45285 | FlyBaseID: | FBgn0000492 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034183.1 | Gene: | Dlx1 / 13390 | MGIID: | 94901 | Length: | 255 | Species: | Mus musculus |
Alignment Length: | 239 | Identity: | 71/239 - (29%) |
---|---|---|---|
Similarity: | 114/239 - (47%) | Gaps: | 55/239 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 PDGLDG--SGKSLESPHGPPPGSHMQSTILSPAALASGHVPI-------RPTPFSALAAAAVAWT 373
Fly 374 GMGGGVPWPGT----RQMPPFGPPGMFPGAGF---------GGDAN-----EPPRIKCNLRKHKP 420
Fly 421 NRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQE---A 482
Fly 483 EIEKIKMA---ALGRGAPGAQ--W-----------AMAGYFHPS 510 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dr | NP_477324.1 | Homeobox | 424..477 | CDD:278475 | 29/52 (56%) |
Dlx1 | NP_034183.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | 10/36 (28%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 95..118 | 3/22 (14%) | |||
Homeobox | 131..185 | CDD:395001 | 29/53 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..233 | 7/28 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |