DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and Msx3

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_446164.1 Gene:Msx3 / 114504 RGDID:620932 Length:204 Species:Rattus norvegicus


Alignment Length:159 Identity:86/159 - (54%)
Similarity:95/159 - (59%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 ALASGHVPIRPTPFSA---LAAAAVAWTGMG-------------GGVPWPGTRQMPPFGPPGMFP 397
            |...||:...|.|||.   |.|..|..:..|             |..|.|.....||..|     
  Rat    15 ARGGGHIEQGPLPFSVESLLEAERVRGSESGELGEERPPGASKPGAWPPPVAHSCPPRAP----- 74

  Fly   398 GAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTE 462
                    :.||   |.|||||.||||||||||.|||:||:||.:||||||||||||||||.|||
  Rat    75 --------SPPP---CTLRKHKTNRKPRTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTE 128

  Fly   463 TQVKIWFQNRRAKAKRLQEAEIEKIKMAA 491
            |||||||||||||||||||||:||:|:.|
  Rat   129 TQVKIWFQNRRAKAKRLQEAELEKLKLTA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 46/52 (88%)
Msx3NP_446164.1 Homeobox 90..144 CDD:395001 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351154
Domainoid 1 1.000 107 1.000 Domainoid score I6381
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 1 1.000 - - otm45164
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.