Sequence 1: | NP_477324.1 | Gene: | Dr / 45285 | FlyBaseID: | FBgn0000492 | Length: | 515 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001795.2 | Gene: | CDX1 / 1044 | HGNCID: | 1805 | Length: | 265 | Species: | Homo sapiens |
Alignment Length: | 220 | Identity: | 64/220 - (29%) |
---|---|---|---|
Similarity: | 89/220 - (40%) | Gaps: | 65/220 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 DSP----RSTPDGLDGSGKSLESPHGPPPG----------SHMQ--------------------- 341
Fly 342 --------STILSPAALASG------HVPIRPTPFSALAAAAVAWTGMGGGVP-WPGTRQMPPFG 391
Fly 392 PPGMFPGAGFGGDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSS 456
Fly 457 SLRLTETQVKIWFQNRRAKAKRLQE 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dr | NP_477324.1 | Homeobox | 424..477 | CDD:278475 | 27/52 (52%) |
CDX1 | NP_001795.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 9..153 | 36/157 (23%) | |
Caudal_act | 13..138 | CDD:282574 | 28/129 (22%) | ||
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 | 157..178 | 8/20 (40%) | |||
Homeobox | 158..210 | CDD:278475 | 27/51 (53%) | ||
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 | 196..207 | 9/10 (90%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 207..265 | 2/8 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |