DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and dlx4

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_002935758.3 Gene:dlx4 / 100494171 XenbaseID:XB-GENE-876742 Length:253 Species:Xenopus tropicalis


Alignment Length:212 Identity:68/212 - (32%)
Similarity:90/212 - (42%) Gaps:70/212 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 STPDGLDGSGKS--LESPHGP---PPGSHMQSTILSPAALASGHVPIR---PTPFSALAAAAVAW 372
            |..|.|....||  ||..|||   |...|      || |||.||.|:.   ||....|       
 Frog     3 SIADSLLDPSKSAFLEFSHGPTSSPQSQH------SP-ALAHGHYPLHGFLPTAHEGL------- 53

  Fly   373 TGMGGGVPWPGTRQMPPFGPPGMFPGAG-------------------------FGGDAN------ 406
              ...|.|..|.|.:|       :|.|.                         .|..|.      
 Frog    54 --FSPGTPSFGGRTLP-------YPYASSSHHHQQQHHHNGSAYLNYQQYTSTIGSSARLHEDQE 109

  Fly   407 -------EPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQ 464
                   |...|:.| .|.|..|||||.:::.||.:|.::|::.|||::.||||.::.|.||:||
 Frog   110 MEKSTVIENGEIRIN-GKGKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERAELAAQLGLTQTQ 173

  Fly   465 VKIWFQNRRAKAKRLQE 481
            |||||||:|:|.|::.:
 Frog   174 VKIWFQNKRSKYKKVMK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 28/52 (54%)
dlx4XP_002935758.3 COG5576 98..239 CDD:227863 38/94 (40%)
Homeobox 133..187 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.