DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dr and nkx6-3

DIOPT Version :9

Sequence 1:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_002932753.1 Gene:nkx6-3 / 100489301 XenbaseID:XB-GENE-478609 Length:255 Species:Xenopus tropicalis


Alignment Length:214 Identity:57/214 - (26%)
Similarity:83/214 - (38%) Gaps:59/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 PRSTP-DGLDGSGKSLESPHGPPPGSHMQSTILSPAALASGHVPIRPTPFSALAAAAVAWTGMGG 377
            |..|| ..|:.|......|.|.|   |..|.|||           ||.|.|        .:||  
 Frog    26 PAHTPFHKLNPSVLGCHLPSGTP---HGISDILS-----------RPLPAS--------HSGM-- 66

  Fly   378 GVPWPGTRQMPPFGPPGMFPGAGFGGD----------------------------ANEPPRIKCN 414
               :||...:..:|...: ||:.:|..                            .|.......|
 Frog    67 ---FPGYPTVQGYGSSSV-PGSCYGEQGSILTKSGTPYTNQSRGCWTDIEQDWRGGNRALSSVSN 127

  Fly   415 LRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRL 479
            .......:..|..||..|:.:|||.|.:.:||:..|||..:.||.::|:|||:||||||.|.:: 
 Frog   128 TEGSSRKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAFSLGMSESQVKVWFQNRRTKWRK- 191

  Fly   480 QEAEIEKIKMAALGRGAPG 498
             ::.:|...:.:|....||
 Frog   192 -KSAVETPGLPSLSTRGPG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrNP_477324.1 Homeobox 424..477 CDD:278475 26/52 (50%)
nkx6-3XP_002932753.1 Homeobox 137..190 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.