DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and CYP712A1

DIOPT Version :9

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:467 Identity:102/467 - (21%)
Similarity:189/467 - (40%) Gaps:70/467 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LPGIGSYSWLRLHQAG-------QDKYEKYGAIVRETIVPGQDIVWLYDPKDIAL-LLNERDCP- 95
            ||.||     .||..|       |....|||.::...:...:.:|  .....:|. :..|::.. 
plant    48 LPFIG-----HLHLIGKVLPVSFQSLAHKYGPLMEIRLGASKCVV--VSSSSVAREIFKEQELNF 105

  Fly    96 QRRSHLALAQYRKSRPDVYKTTGLLPTNGPEWWRIRAQVQKELSAPKSVRNF--------VRQVD 152
            ..|.....|:|.|.|...:    :|...|..|..::.....:|.|...:..|        ::.||
plant   106 SSRPEFGSAEYFKYRGSRF----VLAQYGDYWRFMKKLCMTKLLAVPQLEKFADIREEEKLKLVD 166

  Fly   153 GVTKEFIRFLQESRNGGAIDMLPKLTRLNLELTCLLTFGARLQSFTAQEQDPRSRSTRLMDAAE- 216
            .|.|       ..|.|...|:..:..:....:.|.:....|......:.::.|....:.::.|. 
plant   167 SVAK-------CCREGLPCDLSSQFIKYTNNVICRMAMSTRCSGTDNEAEEIRELVKKSLELAGK 224

  Fly   217 -TTNSCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVALELVEE-----NVRNGS---VGSSLI 272
             :....:.|    |::..|  :.:.:||.......:.:...:::|     ..::|:   :...|:
plant   225 ISVGDVLGP----LKVMDF--SGNGKKLVAVMEKYDLLVERIMKEREAKAKKKDGTRKDILDILL 283

  Fly   273 SAYVKNP----ELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIARNPEVQQKLHEEARRVLPSA 333
            ..| ::|    ::.|:|:.....|:.:||.||::.|..:.:..:..:|:...||.||...|:.|.
plant   284 ETY-RDPTAEMKITRNDMKSFLLDVFMAGTDTSAAAMQWAMGQLINHPQAFNKLREEINNVVGSK 347

  Fly   334 KDELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKGTTVVTQNMVACRLE 398
            :  |..::...::.|.||||:|:|||:|.|..:.|...:|...:|..|...|.|:.......|..
plant   348 R--LVKESDVPNLPYLRAVLRETLRLHPSAPLIIRECAEDCQVNGCLVKSKTRVLVNVYAIMRDS 410

  Fly   399 QHFQDPLRFQPDRWL--------QHRSAL--NPYLVLPFGHGMRACIARRLAEQNMHILLLRLLR 453
            :.:.|..||.|:|:|        :|:...  ..:..||||.|.|.|....||...|||.:..|::
plant   411 ELWADADRFIPERFLESSEEKIGEHQMQFKGQNFRYLPFGSGRRGCPGASLAMNVMHIGVGSLVQ 475

  Fly   454 EYELIWSGSDDE 465
            .::  |...|.:
plant   476 RFD--WKSVDGQ 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 97/446 (22%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 102/467 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.