DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and CYP71A12

DIOPT Version :9

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_180633.3 Gene:CYP71A12 / 817626 AraportID:AT2G30750 Length:497 Species:Arabidopsis thaliana


Alignment Length:487 Identity:106/487 - (21%)
Similarity:186/487 - (38%) Gaps:101/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LPGIGSYSWLRL--HQAGQDKYEKYGAIVRETIVPGQDIVWLYDPKDIALLLNERDCPQR--RSH 100
            ||.||:...|.|  |::......:||           .::.|:..:...|:::..:..|.  ::|
plant    40 LPLIGNLHQLSLHPHRSLHSLSLRYG-----------PLMLLHFGRVPILVVSSGEAAQEVLKTH 93

  Fly   101 -LALAQYRKSRPDVYKTTGLLPTN-----GP--EWWR-IRAQVQKELSAPKSVRNFVRQVDGVTK 156
             |..|    :||......||:...     ||  |:|| :::.....|...|.|.:|.:..:....
plant    94 DLKFA----NRPRSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELN 154

  Fly   157 EFIRFLQESRNGGAIDMLPKL-TRLNLELTCLLTFGARLQSFTAQEQDPRSRSTRLM-------- 212
            |.|:.|:::.:..:.:.|.:| ..|..::|..:..| |..|.....:|.:.|..::|        
plant   155 EMIKKLEKASSSSSSENLSELFVTLPSDVTSRIALG-RKHSEDETARDLKKRVRQIMELLGEFPI 218

  Fly   213 ----------DAAETTNSCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVALELVEENVRNGSV 267
                      |.....|:.|....||.                 ...|:.|..|.:|........
plant   219 GDYVPALAWIDRINGFNARIKEVSQGF-----------------SDLMDKVVQEHLEAGNHKEDF 266

  Fly   268 GSSLISAYVKNP---ELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIARNPEVQQKLHEEARRV 329
            ...|:|...:..   :..|.|:.....|:.:.|..|:|....:::..:.|||.|.:||.:|.|..
plant   267 VDILLSIESEKSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRST 331

  Fly   330 L-PSAKDELSMDALRTDITYTRAVLKESLRLN-PIAVGVGRILNQDAIFSGYFVPKGTTVVTQNM 392
            : |........|.  .::.|.:||:||..|:: |:.:.:.|:|::|....||.:..||.|:....
plant   332 IRPHGSYIKEKDV--ENMKYLKAVIKEVFRVHPPLPLILPRLLSEDVKVKGYNIAAGTEVIINAW 394

  Fly   393 VACRLEQHFQDPL-------RFQPDRWLQ-----HRSALNPYLVLPFGHGMRACIARRLAEQNMH 445
            ...|      ||.       .|:|:|.|.     |...||   .:|||.|.|.|....||...:.
plant   395 AIQR------DPAIWGPDAEEFKPERHLDSTLDYHGKDLN---FIPFGSGRRICPGINLALGLVE 450

  Fly   446 ILLLRLLREYELIWSGSDDEMGVKTLLINKPD 477
            :.:..|:..::  |.......|      ::||
plant   451 VTVANLVGRFD--WRAEAGPNG------DQPD 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 101/454 (22%)
CYP71A12NP_180633.3 CYP71-like 63..489 CDD:410695 99/464 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.