DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and Cyp6a13

DIOPT Version :9

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster


Alignment Length:488 Identity:111/488 - (22%)
Similarity:193/488 - (39%) Gaps:112/488 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QAIPGPRGPFGMGNLYNYLPGIG-SYSW----LRLHQ--AGQDKYEKYGAIVRETIVPGQDIVWL 79
            :.:.|.|..:..||    :.|:| ...|    ||:::  .|.::|..|...:.:::.. .|:..:
  Fly    29 RGVAGERPVYFRGN----MSGLGRDLHWTDINLRIYRKFRGVERYCGYFTFMTKSLFI-MDLELI 88

  Fly    80 YDP--------KDIALLLNERDCPQRRSHLALAQYRKSRPDVYKTTGLLPTNGPEWWRIRAQVQK 136
            .|.        .|..|..|.||.|                   .|..||..:||||..:|..:.:
  Fly    89 RDIMIRDFSSFADRGLFHNVRDDP-------------------LTGNLLFLDGPEWRWLRQNLTQ 134

  Fly   137 ELSAPKSVRNFVRQVDGVTKEFIRFLQESR-NGGAIDMLPKLTRLNLELTCLLTFGARLQSFTAQ 200
            ..::.|....|...|:...|    ..|..| ..|.|:......|...::.....||....|.   
  Fly   135 VFTSGKMKFMFPNMVEVGEK----LTQACRLQVGEIEAKDLCARFTTDVIGSCAFGLECNSL--- 192

  Fly   201 EQDPRSRSTRLMDAA--ETTNSCILPTDQGLQLWRFLETPSFRKL-------SQAQSYMESV--- 253
             |||.|:..|:..:.  |..:|.:      :|.:.|.:....|||       ..::.::::|   
  Fly   193 -QDPESQFRRMGRSVTQEPLHSVL------VQAFMFAQPELARKLRFRLFRPEVSEFFLDTVRQT 250

  Fly   254 -----------------ALELVEENVRNGSVGSSLISAYVKNPELDRSDVVGTAADLLLAGIDTT 301
                             .:||.||.|::.               |....:...|....|||.||:
  Fly   251 LDYRRRENIHRNDLIQLLMELGEEGVKDA---------------LSFEQIAAQALVFFLAGFDTS 300

  Fly   302 SYASAFLLYHIARNPEVQQKLHEEARRVLPSAKDELSMDALRTDITYTRAVLKESLRLNPIAVGV 366
            |...:|.||.:|.||:||::|..|...||.....:|:.|::: ::.|...|:.|:||..||...:
  Fly   301 STTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQ-EMPYLDQVVAETLRKYPILPHL 364

  Fly   367 GRILNQDAIFSGYFVPKGTTVV---TQNMVACRLEQH----FQDPLRFQPDRW-LQHRSALNPYL 423
            .|...::     |.:|....::   ::.::......|    :.||.:|.|.|: .:...|.:|:.
  Fly   365 LRRSTKE-----YQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFA 424

  Fly   424 VLPFGHGMRACIARRLAEQNMHILLLRLLREYE 456
            .||||.|.|.||..|..:..:.:.|:.|||:::
  Fly   425 YLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 107/473 (23%)
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 111/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.