DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and Cyp28d1

DIOPT Version :9

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster


Alignment Length:403 Identity:81/403 - (20%)
Similarity:150/403 - (37%) Gaps:89/403 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LAQYRKSRPDVYKTTGLLPTNGPEWWRIRAQVQKELSA-------PKSVRNFVRQVDGVTKEFIR 160
            :|::..|:.|...........|..|...||:|...|||       |.|:|        |.|:|:.
  Fly   108 MAKFTDSKTDPILANNPFVLTGEAWKERRAEVTPGLSANRVKAAYPVSLR--------VCKKFVE 164

  Fly   161 FLQESRNGGAIDMLPKLTRLNLELTCL---------LTFGARLQSFTAQEQDPRSRSTRLMDAAE 216
            :::..      .::.....||.:..||         ...|...||||.........:.|:.   |
  Fly   165 YIRRQ------SLMAPAQGLNAKDLCLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVF---E 220

  Fly   217 TTNSCILPTDQGLQLWRFLETPSFRKLSQAQSYMESVA---LELVEE--NVRNGSVGSSLISAYV 276
            .:...|..|... .||     |...|......:.:.||   .:|:::  .||..|..:.....::
  Fly   221 QSFGFIFYTVVA-NLW-----PPITKFYSVSLFAKDVAAFFYDLMQKCIQVRRESPAAQQRDDFL 279

  Fly   277 -------KNPELDRSDVVGTAADLLLAGIDTTSYASAFLLYHIARNPEVQQKLHEEARRVLPSAK 334
                   :...|:.:::.......|..|.:||:......|..:||||:.|.||.||.      ..
  Fly   280 NYMLQLQEKKGLNAAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GT 338

  Fly   335 DELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKGTTVVTQNMVACRLE- 398
            .||:.:.: :::.:|.|.:.|:||:....:...:::.:..           .:..:|.|:.:|. 
  Fly   339 AELTFEQI-SELPFTEACIHETLRIFSPVLAARKVVTEPC-----------ELTNKNGVSVKLRP 391

  Fly   399 ---------------QHFQDPLRFQPDRWLQHRSALNPY----LVLPFGHGMRACIARRLAEQNM 444
                           |::::|..|:|:|:|........|    |...||.|.|.|...|.:...:
  Fly   392 GDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQI 456

  Fly   445 HILLLRLLREYEL 457
            ...|:.::|.:::
  Fly   457 KAALVEIVRNFDI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 79/390 (20%)
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 81/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.