DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and Cyp28d2

DIOPT Version :9

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster


Alignment Length:471 Identity:105/471 - (22%)
Similarity:190/471 - (40%) Gaps:96/471 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PGIGSYSWLRLHQAG-----QDKYEKYGAIVRETIVPGQDIVWLYDPKDIALLLNERDCPQRRSH 100
            |.:||:..:...:..     .|.||||    ::|    .::|.::..:...||:.   ||:....
  Fly    41 PFVGSFPSIFTRKRNIAYDIDDIYEKY----KDT----DNMVGVFTTRVPQLLVM---CPEYIHK 94

  Fly   101 LALAQYR-----KSRPDVYKTTGLLPTNGP------EWWRIRAQVQKELSAPKSVRNFVRQVDGV 154
            :....:|     :.|..|.|.|.::..|.|      ||...|:::...|| |..|:........|
  Fly    95 IYATDFRSFHNNEWRNFVNKKTDMILGNNPFVLTGDEWKERRSEIMPALS-PNRVKAVYPVSQSV 158

  Fly   155 TKEFIRFL---QESRNGGAIDMLPKLTRLNLELTCLLTFGARLQSFTAQEQDPRSRSTRLMDAAE 216
            .|:|:.::   |:......:|.:........|:......|...||||    |..:...:::....
  Fly   159 CKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLGVSAQSFT----DTPTPLLKMIKRVF 219

  Fly   217 TTNSCILPTDQGLQLW----RFLETPSFRKLSQAQSYMESVALELVEENVRNGSVGSSLISAYVK 277
            .|:...:.......||    :|...|.|.|.:      |...|:::..          .|:..::
  Fly   220 NTSFEFIFYSVVTNLWQKVRKFYSVPFFNKET------EVFFLDIIRR----------CITLRLE 268

  Fly   278 NPELDRSDVVGTAADL------------------LLAGIDTTSYASAFLLYHIARNPEVQQKLHE 324
            .||..|.|.:.....|                  :|.|.:||:...|.::..:.||||.|.|:.:
  Fly   269 KPEQQRDDFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRK 333

  Fly   325 EARRVLPSAKDELSMDALRTDITYTRAVLKESLRLNPIAVGVGRILNQDAIFSGYFVPKGTT--- 386
            |    :.||  :|:.|.: :::.:..|.:.|:|||....|...:::.:...|:.   ..|.|   
  Fly   334 E----IGSA--DLTFDQM-SELPHLDACIYETLRLFSPQVAARKLVTEPFEFAN---KNGRTVHL 388

  Fly   387 ----VVTQNMVACRLE-QHFQDPLRFQPDRWLQ-HRSALNPY----LVLPFGHGMRACIARRLAE 441
                |||..:.|...: |:::|||.|:|:|:|: :...:..|    :.|.||.|.|.|...|.|.
  Fly   389 KPGDVVTIPVKALHHDPQYYEDPLTFKPERFLESNGGGMKSYRDRGVYLAFGDGPRHCPGMRFAL 453

  Fly   442 QNMHILLLRLLREYEL 457
            ..:...|:.:||.:|:
  Fly   454 TQLKAALVEILRNFEI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 p450 25..446 CDD:299894 101/458 (22%)
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 105/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.