DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dib and Cyp318a1

DIOPT Version :10

Sequence 1:NP_524810.2 Gene:dib / 45282 FlyBaseID:FBgn0000449 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:53 Identity:12/53 - (22%)
Similarity:19/53 - (35%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLVVVGS-ANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGAKLMYP 121
            |:..:|: .|.|:.|:|:              ..|.|.|....:|...|...|
  Fly     9 PVDAIGNHKNTDLDVDID--------------DELFGKKPPKASASATKAAAP 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dibNP_524810.2 CYP24A1-like 59..480 CDD:410677 12/53 (23%)
Cyp318a1NP_727590.1 CYP313-like 69..525 CDD:410680
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.