DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cv-2 and FCGBP

DIOPT Version :9

Sequence 1:NP_524809.2 Gene:cv-2 / 45280 FlyBaseID:FBgn0000395 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_003881.2 Gene:FCGBP / 8857 HGNCID:13572 Length:5405 Species:Homo sapiens


Alignment Length:557 Identity:149/557 - (26%)
Similarity:224/557 - (40%) Gaps:105/557 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GSEWNDPE-DPCKTYKCVATVVTETIQKCYSQCDNNQL-QPPRPGECCPTCQGCKINGQ-TVAEG 194
            |..|..|. ||....:|..:..|         |..::| |...||.|.|...|  ..|. |....
Human  1841 GGSWRAPGWDPLCWDECRGSCPT---------CPEDRLEQYEGPGFCGPLAPG--TGGPFTTCHA 1894

  Fly   195 HEVDASIDDRCLVCQCRG---TQLTCSKKTCPVLPCPMSKQI----KRPDECCPRCPQNHSFLPV 252
            |....|....|::..|.|   ..:.|......|..|..:..:    :....|...||:|..:...
Human  1895 HVPPESFFKGCVLDVCMGGGDRDILCKALASYVAACQAAGVVIEDWRAQVGCEITCPENSHYEVC 1959

  Fly   253 PGKCLFNKSVYPEKTQFMPDRCTNCTCLNGTSVCQRPTCPILECAPEF-QEPDGCCP---RCAVA 313
            ...|              |..|.:...|...:||:.|.....:|...| ...|.|.|   .|.  
Human  1960 GSPC--------------PASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADRCVPLNNGCG-- 2008

  Fly   314 EVRSECSLDGIVYQ-NNETWDMGPCRS-CRC--NGGTIRCAQMRCPAVKCRANEELKQPPGECC- 373
                 |..:|..:: .:|.|..|.|.. |||  .||::.|....|..             ||.| 
Human  2009 -----CWANGTYHEAGSEFWADGTCSQWCRCGPGGGSLVCTPASCGL-------------GEVCG 2055

  Fly   374 ------QRC--VETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMG-----KTFHIRLTNE 425
                  ..|  |.|| .|..:||||:.|.||..|:|||:|:|||::.|.|     :.|.:.:.||
Human  2056 LLPSGQHGCQPVSTA-ECQAWGDPHYVTLDGHRFNFQGTCEYLLSAPCHGPPLGAENFTVTVANE 2119

  Fly   426 GRGTRRASWAKTVTLSLRNLKVNLGQR--MRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVML 488
            .||::..|:.::|||.:.|..:.|..|  .:::|:|..||||:.:     :..:....:|..|::
Human  2120 HRGSQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVTLPFQL-----DSLLHAHLSGADVVV 2179

  Fly   489 RSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKV 553
            .:..||:|.::|..|:::.|||.:...|||||||:|....|||....|:..|          |:|
Human  2180 TTTSGLSLAFDGDSFVRLRVPAAYAGSLCGLCGNYNQDPADDLKAVGGKPAG----------WQV 2234

  Fly   554 GGPKSCSRKREFLAATPTCDKRKSNF----YCHPLS-VPALFGECNERLNPENYKAACRMDVCEC 613
            ||.:.|.........:|...:::.:|    .|..:| .......|:..:.|..|...|.:|.|:.
Human  2235 GGAQGCGECVSKPCPSPCTPEQQESFGGPDACGVISATDGPLAPCHGLVPPAQYFQGCLLDACQV 2299

  Fly   614 ---PSGDCHCDSFAAYAHECRRLGVQLPDWRSATNCP 647
               |.|  .|.:.|.|...|:..|.||.:||....||
Human  2300 QGHPGG--LCPAVATYVAACQAAGAQLREWRRPDFCP 2334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cv-2NP_524809.2 VWC 184..243 CDD:214564 11/66 (17%)
VWC 256..310 CDD:278520 12/57 (21%)
VWC 319..376 CDD:214564 16/67 (24%)
VWD 371..536 CDD:214566 63/180 (35%)
C8 580..646 CDD:285899 19/69 (28%)
FCGBPNP_003881.2 IgGFc-binding 24..450
VWD 472..627 CDD:278521
C8 667..742 CDD:214843
TIL 745..799 CDD:280072
VWD 864..1019 CDD:278521
C8 1060..1133 CDD:214843
TIL 1136..1189 CDD:280072
VWC 1194..1245 CDD:302663
VWD 1252..1407 CDD:278521
C8 1454..1529 CDD:214843
TIL 1532..1585 CDD:280072
VWC 1587..1640 CDD:302663
VWD 1673..1832 CDD:278521
C8 1871..1946 CDD:214843 16/76 (21%)
TIL 1950..2004 CDD:280072 15/67 (22%)
VWD 2072..2222 CDD:278521 55/154 (36%)
C8 2260..2334 CDD:214843 20/75 (27%)
TIL 2337..2390 CDD:280072
VWC 2398..2446 CDD:302663
VWD 2453..2608 CDD:278521
C8 2655..2730 CDD:214843
TIL 2733..2786 CDD:280072
VWC 2788..2841 CDD:302663
VWD 2874..3033 CDD:278521
C8 3072..3147 CDD:214843
TIL 3151..3205 CDD:280072
VWD 3273..3423 CDD:278521
C8 3461..3535 CDD:214843
TIL 3538..3591 CDD:280072
VWC 3599..3647 CDD:302663
VWD 3654..3809 CDD:278521
C8 3856..3931 CDD:214843
TIL 3934..3987 CDD:280072
VWC 3989..4042 CDD:302663
VWD 4075..4234 CDD:278521
C8 4273..4348 CDD:214843
TIL 4352..4406 CDD:280072
VWD 4474..4624 CDD:278521
C8 4662..4736 CDD:214843
TIL 4739..4792 CDD:280072
VWC 4797..4849 CDD:302663
VWD 4856..5003 CDD:278521
C8 5044..5118 CDD:214843
TIL 5121..5174 CDD:280072
VWD 5235..5382 CDD:295339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5817
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.